| Class b: All beta proteins [48724] (144 folds) |
| Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (8 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (1 species) duplication: contains tandem repeat of two similar domains |
| Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (6 PDB entries) |
| Domain d1uova_: 1uov A: [107974] |
PDB Entry: 1uov (more details), 1.65 Å
SCOP Domain Sequences for d1uova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uova_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus)}
leklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
wsdmlanprrpiaqwhtlqveeevdamlav
Timeline for d1uova_: