![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein M (medium) subunit [81481] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries) Uniprot P02953 |
![]() | Domain d1umxm_: 1umx M: [107964] Other proteins in same PDB: d1umxh1, d1umxh2, d1umxl_ complexed with bcl, bpb, fe, lda, po4, spn, u10; mutant |
PDB Entry: 1umx (more details), 2.8 Å
SCOPe Domain Sequences for d1umxm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umxm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihlwaiwmavlvtltggigillsgtvvdnwyvwgqn hgm
Timeline for d1umxm_: