Lineage for d1umxm_ (1umx M:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239027Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1239028Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1239029Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1239107Protein M (medium) subunit [81481] (3 species)
  7. 1239108Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries)
    Uniprot P02953
  8. 1239151Domain d1umxm_: 1umx M: [107964]
    Other proteins in same PDB: d1umxh1, d1umxh2, d1umxl_
    complexed with bcl, bpb, fe, lda, po4, spn, u10; mutant

Details for d1umxm_

PDB Entry: 1umx (more details), 2.8 Å

PDB Description: photosynthetic reaction center mutant with arg m267 replaced with leu (chain m, r267l)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1umxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umxm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihlwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOPe Domain Coordinates for d1umxm_:

Click to download the PDB-style file with coordinates for d1umxm_.
(The format of our PDB-style files is described here.)

Timeline for d1umxm_: