Lineage for d1ulif_ (1uli F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181740Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2181744Protein Biphenyl dioxygenase small subunit BphA2 [110824] (1 species)
  7. 2181745Species Rhodococcus sp. RHA1 [TaxId:101510] [110825] (2 PDB entries)
    Uniprot Q53123 11-187
  8. 2181748Domain d1ulif_: 1uli F: [107929]
    Other proteins in same PDB: d1ulia1, d1ulia2, d1ulic1, d1ulic2, d1ulie1, d1ulie2
    complexed with fe2, fes

Details for d1ulif_

PDB Entry: 1uli (more details), 2.2 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1
PDB Compounds: (F:) biphenyl dioxygenase small subunit

SCOPe Domain Sequences for d1ulif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulif_ d.17.4.4 (F:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. RHA1 [TaxId: 101510]}
frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff

SCOPe Domain Coordinates for d1ulif_:

Click to download the PDB-style file with coordinates for d1ulif_.
(The format of our PDB-style files is described here.)

Timeline for d1ulif_: