| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Intersectin 2 (KIAA1256) [101669] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries) Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186 |
| Domain d1uhfa_: 1uhf A: [107848] structural genomics; third SH3 domain |
PDB Entry: 1uhf (more details)
SCOPe Domain Sequences for d1uhfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
gssgssggeeyialypyssvepgdltftegeeilvtqkdgewwtgsigdrsgifpsnyvk
pkdsgpssg
Timeline for d1uhfa_: