Lineage for d1uhfa_ (1uhf A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946432Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 946433Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
    Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186
  8. 946435Domain d1uhfa_: 1uhf A: [107848]
    structural genomics; third SH3 domain

Details for d1uhfa_

PDB Entry: 1uhf (more details)

PDB Description: solution structure of the third sh3 domain of human intersectin 2(kiaa1256)
PDB Compounds: (A:) Intersectin 2

SCOPe Domain Sequences for d1uhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
gssgssggeeyialypyssvepgdltftegeeilvtqkdgewwtgsigdrsgifpsnyvk
pkdsgpssg

SCOPe Domain Coordinates for d1uhfa_:

Click to download the PDB-style file with coordinates for d1uhfa_.
(The format of our PDB-style files is described here.)

Timeline for d1uhfa_: