SCOP 1.75: Domain d1uhe.1: 1uhe B:,A:

Lineage for d1uhe.1 (1uhe B:,A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Helicobacter pylori [TaxId:210] [110249] (2 PDB entries)
   Uniprot P56065

8. Domain d1uhe.1: 1uhe B:,A: [107847]
   complexed with nsn

Details for d1uhe.1

PDB Entry: 1uhe, 1.55 Å

PDB Description: Crystal structure of aspartate decarboxylase, isoaspargine complex

PDB Compounds: (A:) Aspartate 1-decarboxylase alpha chain, (B:) Aspartate 1-decarboxylase beta chain

SCOP Domain Sequences for d1uhe.1:

Sequence; same for both SEQRES and ATOM records:

>g1uhe.1 b.52.2.1 (B:,A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Helicobacter pylori [TaxId: 210]}
mtfemlyskihratitdanlnyigXitidedlaklaklregmkveivdvnngerfstyvi
lgkkrgeicvngaaarkvaigdvviilayasmnedeinahkpsivlvdekneilekgleh
hh

Timeline for d1uhe.1:

• d1uhe.1 first appeared in SCOP 1.69
  
• d1uhe.1 appears in SCOP 1.73
  
• d1uhe.1 appears in SCOPe 2.01
  
• d1uhe.1 appears in the current release, SCOPe 2.08