Lineage for d1uhe.1 (1uhe B:,A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467167Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)
  6. 467168Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 467187Species Helicobacter pylori [TaxId:210] [110249] (2 PDB entries)
  8. 467188Domain d1uhe.1: 1uhe B:,A: [107847]

Details for d1uhe.1

PDB Entry: 1uhe (more details), 1.55 Å

PDB Description: Crystal structure of aspartate decarboxylase, isoaspargine complex

SCOP Domain Sequences for d1uhe.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1uhe.1 b.52.2.1 (B:,A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Helicobacter pylori}
mtfemlyskihratitdanlnyigXitidedlaklaklregmkveivdvnngerfstyvi
lgkkrgeicvngaaarkvaigdvviilayasmnedeinahkpsivlvdekneilekgleh
hh

SCOP Domain Coordinates for d1uhe.1:

Click to download the PDB-style file with coordinates for d1uhe.1.
(The format of our PDB-style files is described here.)

Timeline for d1uhe.1: