SCOPe 2.08: Domain d1ufna1: 1ufn A:8-88

Lineage for d1ufna1 (1ufn A:8-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.217: SAND domain-like [63762] (1 superfamily)
   core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold

4. Superfamily d.217.1: SAND domain-like [63763] (2 families)

5. Family d.217.1.1: SAND domain [63764] (3 proteins)
   automatically mapped to Pfam PF01342

6. Protein Putative nuclear protein homolog 5830484a20rik [110846] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110847] (1 PDB entry)
   Uniprot Q8BVK9 353-433

8. Domain d1ufna1: 1ufn A:8-88 [107817]
   Other proteins in same PDB: d1ufna2, d1ufna3
   Structural genomics target

Details for d1ufna1

PDB Entry: 1ufn

PDB Description: solution structure of the sand domain of the putative nuclear protein homolog (5830484a20rik)

PDB Compounds: (A:) putative nuclear protein homolog 5830484A20Rik

SCOPe Domain Sequences for d1ufna1:

Sequence; same for both SEQRES and ATOM records:

>d1ufna1 d.217.1.1 (A:8-88) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]}
ndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflneggratskdw
kgvircngetlrhleqkgllf

Timeline for d1ufna1:

• d1ufna1 first appeared in SCOP 1.69, called d1ufna_
  
• d1ufna1 appears in SCOPe 2.07