Lineage for d1ufna1 (1ufn A:8-88)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. Family d.217.1.1: SAND domain [63764] (3 proteins)
    automatically mapped to Pfam PF01342
  6. Protein Putative nuclear protein homolog 5830484a20rik [110846] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [110847] (1 PDB entry)
    Uniprot Q8BVK9 353-433
  8. Domain d1ufna1: 1ufn A:8-88 [107817]
    Other proteins in same PDB: d1ufna2, d1ufna3
    Structural genomics target

Details for d1ufna1

PDB Entry: 1ufn (more details)

PDB Description: Solution structure of the SAND domain of the putative nuclear protein homolog (5830484A20Rik)
PDB Compounds: (A:) putative nuclear protein homolog 5830484A20Rik

SCOPe Domain Sequences for d1ufna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufna1 d.217.1.1 (A:8-88) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]}
ndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflneggratskdw
kgvircngetlrhleqkgllf

SCOPe Domain Coordinates for d1ufna1 are not available.

Timeline for d1ufna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ufna2, d1ufna3