![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.217: SAND domain-like [63762] (1 superfamily) core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold |
![]() | Superfamily d.217.1: SAND domain-like [63763] (2 families) ![]() |
![]() | Family d.217.1.1: SAND domain [63764] (3 proteins) automatically mapped to Pfam PF01342 |
![]() | Protein Putative nuclear protein homolog 5830484a20rik [110846] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110847] (1 PDB entry) Uniprot Q8BVK9 353-433 |
![]() | Domain d1ufna1: 1ufn A:8-88 [107817] Other proteins in same PDB: d1ufna2, d1ufna3 Structural genomics target |
PDB Entry: 1ufn (more details)
SCOPe Domain Sequences for d1ufna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufna1 d.217.1.1 (A:8-88) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} ndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflneggratskdw kgvircngetlrhleqkgllf
Timeline for d1ufna1: