Lineage for d1ufna1 (1ufn A:8-88)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563546Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 2563547Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 2563548Family d.217.1.1: SAND domain [63764] (3 proteins)
    automatically mapped to Pfam PF01342
  6. 2563556Protein Putative nuclear protein homolog 5830484a20rik [110846] (1 species)
  7. 2563557Species Mouse (Mus musculus) [TaxId:10090] [110847] (1 PDB entry)
    Uniprot Q8BVK9 353-433
  8. 2563558Domain d1ufna1: 1ufn A:8-88 [107817]
    Other proteins in same PDB: d1ufna2, d1ufna3
    Structural genomics target

Details for d1ufna1

PDB Entry: 1ufn (more details)

PDB Description: Solution structure of the SAND domain of the putative nuclear protein homolog (5830484A20Rik)
PDB Compounds: (A:) putative nuclear protein homolog 5830484A20Rik

SCOPe Domain Sequences for d1ufna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufna1 d.217.1.1 (A:8-88) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]}
ndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflneggratskdw
kgvircngetlrhleqkgllf

SCOPe Domain Coordinates for d1ufna1:

Click to download the PDB-style file with coordinates for d1ufna1.
(The format of our PDB-style files is described here.)

Timeline for d1ufna1: