PDB entry 1ufn

View 1ufn on RCSB PDB site
Description: Solution structure of the SAND domain of the putative nuclear protein homolog (5830484A20Rik)
Class: Structural genomics, unknown function
Keywords: SAND DOMAIN, KDWK motif, nuclear protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-06-02, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative nuclear protein homolog 5830484A20Rik
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5830484A20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BVK9 (7-87)
      • cloning artifact (0-6)
      • cloning artifact (88-93)
    Domains in SCOPe 2.08: d1ufna1, d1ufna2, d1ufna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufnA (A:)
    gssgssgndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflnegg
    ratskdwkgvircngetlrhleqkgllfsgpssg