Lineage for d1ua5a2 (1ua5 A:1-80)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486675Protein Class alpha GST [81360] (8 species)
  7. 486748Species Schistosoma japonicum [TaxId:6182] [52878] (9 PDB entries)
  8. 486753Domain d1ua5a2: 1ua5 A:1-80 [107758]
    Other proteins in same PDB: d1ua5a1

Details for d1ua5a2

PDB Entry: 1ua5 (more details), 2.5 Å

PDB Description: non-fusion gst from s. japonicum in complex with glutathione

SCOP Domain Sequences for d1ua5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua5a2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

SCOP Domain Coordinates for d1ua5a2:

Click to download the PDB-style file with coordinates for d1ua5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ua5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua5a1