SCOP 1.69: Domain d1ua5a1: 1ua5 A:81-215

Lineage for d1ua5a1 (1ua5 A:81-215)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (9 PDB entries)

8. Domain d1ua5a1: 1ua5 A:81-215 [107757]
   Other proteins in same PDB: d1ua5a2

Details for d1ua5a1

PDB Entry: 1ua5, 2.5 Å

PDB Description: non-fusion gst from s. japonicum in complex with glutathione

SCOP Domain Sequences for d1ua5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ua5a1 a.45.1.1 (A:81-215) Class alpha GST {Schistosoma japonicum}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhp

Timeline for d1ua5a1:

• d1ua5a1 is new in SCOP 1.69
  
• d1ua5a1 appears in SCOP 1.71
  
• d1ua5a1 appears in the current release, SCOPe 2.08