Lineage for d1u9db1 (1u9d B:1-107)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526978Family d.80.1.5: VC0714-like [111043] (1 protein)
    automatically mapped to Pfam PF08921
  6. 2526979Protein Hypothetical protein VC0714 [111044] (1 species)
  7. 2526980Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry)
    Uniprot Q9KU16
  8. 2526982Domain d1u9db1: 1u9d B:1-107 [107750]
    Other proteins in same PDB: d1u9da2, d1u9db2
    complexed with po4

Details for d1u9db1

PDB Entry: 1u9d (more details), 1.7 Å

PDB Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (B:) hypothetical protein VC0714

SCOPe Domain Sequences for d1u9db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9db1 d.80.1.5 (B:1-107) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]}
mphlrfraveahiveslvptllnelssllstarnaftfelintqyfaeggvypmvevlwf
greqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgqhf

SCOPe Domain Coordinates for d1u9db1:

Click to download the PDB-style file with coordinates for d1u9db1.
(The format of our PDB-style files is described here.)

Timeline for d1u9db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u9db2