Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.5: VC0714-like [111043] (1 protein) automatically mapped to Pfam PF08921 |
Protein Hypothetical protein VC0714 [111044] (1 species) |
Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry) Uniprot Q9KU16 |
Domain d1u9db1: 1u9d B:1-107 [107750] Other proteins in same PDB: d1u9da2, d1u9db2 complexed with po4 |
PDB Entry: 1u9d (more details), 1.7 Å
SCOPe Domain Sequences for d1u9db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9db1 d.80.1.5 (B:1-107) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} mphlrfraveahiveslvptllnelssllstarnaftfelintqyfaeggvypmvevlwf greqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgqhf
Timeline for d1u9db1: