SCOPe 2.08: Domain d1u9db1: 1u9d B:1-107

Lineage for d1u9db1 (1u9d B:1-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.5: VC0714-like [111043] (1 protein)
   automatically mapped to Pfam PF08921

6. Protein Hypothetical protein VC0714 [111044] (1 species)

7. Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry)
   Uniprot Q9KU16

8. Domain d1u9db1: 1u9d B:1-107 [107750]
   Other proteins in same PDB: d1u9da2, d1u9db2
   complexed with po4

Details for d1u9db1

PDB Entry: 1u9d, 1.7 Å

PDB Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961

PDB Compounds: (B:) hypothetical protein VC0714

SCOPe Domain Sequences for d1u9db1:

Sequence; same for both SEQRES and ATOM records:

>d1u9db1 d.80.1.5 (B:1-107) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]}
mphlrfraveahiveslvptllnelssllstarnaftfelintqyfaeggvypmvevlwf
greqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgqhf

Timeline for d1u9db1:

• d1u9db1 first appeared in SCOP 1.69, called d1u9db_
  
• d1u9db1 appears in SCOPe 2.07