Lineage for d1u9db_ (1u9d B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506749Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 506750Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) (S)
  5. 506894Family d.80.1.5: VC0714-like [111043] (1 protein)
  6. 506895Protein Hypothetical protein VC0714 [111044] (1 species)
  7. 506896Species Vibrio cholerae [TaxId:666] [111045] (1 PDB entry)
  8. 506898Domain d1u9db_: 1u9d B: [107750]

Details for d1u9db_

PDB Entry: 1u9d (more details), 1.7 Å

PDB Description: Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961

SCOP Domain Sequences for d1u9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9db_ d.80.1.5 (B:) Hypothetical protein VC0714 {Vibrio cholerae}
gvdlgtenlyfssnamphlrfraveahiveslvptllnelssllstarnaftfelintqy
faeggvypmvevlwfgreqqtqdqiaqvitdqirqllgadshlavvfiplqrtayyldgq
hf

SCOP Domain Coordinates for d1u9db_:

Click to download the PDB-style file with coordinates for d1u9db_.
(The format of our PDB-style files is described here.)

Timeline for d1u9db_: