SCOPe 2.08: Domain d1u56a_: 1u56 A:

Lineage for d1u56a_ (1u56 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.1: H-NOX domain [111127] (2 proteins)
   binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
   automatically mapped to Pfam PF07700

6. Protein Methyl-accepting chemotaxis protein [111128] (1 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries)
   Uniprot Q8RBX6 1-191

8. Domain d1u56a_: 1u56 A: [107679]
   complexed with cl, hem

Details for d1u56a_

PDB Entry: 1u56, 1.9 Å

PDB Description: Crystal structure of an oxygen binding H-NOX domain related to soluble guanylate cyclases (Water-ligated, ferric form)

PDB Compounds: (A:) Heme-based Methyl-accepting Chemotaxis Protein

SCOPe Domain Sequences for d1u56a_:

Sequence; same for both SEQRES and ATOM records:

>d1u56a_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfeykkn

Timeline for d1u56a_:

• d1u56a_ first appeared in SCOP 1.69
  
• d1u56a_ appears in SCOPe 2.07