![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein DNA polymerase I (Klenow fragment) [56674] (3 species) |
![]() | Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries) Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462 Uniprot Q45458 298-876 # 88% sequence identity |
![]() | Domain d1u49a2: 1u49 A:469-876 [107663] Other proteins in same PDB: d1u49a1 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 1u49 (more details), 2.15 Å
SCOPe Domain Sequences for d1u49a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u49a2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d1u49a2: