Lineage for d1u3da1 (1u3d A:198-497)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446367Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 446368Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 446369Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 446384Protein Cryptochrome C-terminal domain [81841] (2 species)
  7. 446388Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109947] (2 PDB entries)
  8. 446389Domain d1u3da1: 1u3d A:198-497 [107638]
    Other proteins in same PDB: d1u3da2

Details for d1u3da1

PDB Entry: 1u3d (more details), 2.45 Å

PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana with AMPPNP bound

SCOP Domain Sequences for d1u3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3da1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana)}
eddsekgsnallarawspgwsngdkalttfingplleysknrrkadsattsflsphlhfg
evsvrkvfhlvrikqvawanegneageesvnlflksiglreysryisfnhpysherpllg
hlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdrirvvvssffvkvlqlpw
rwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpqfegykfdpngeyvrrwl
pelsrlptdwihhpwnapesvlqaagielgsnyplpivgldeakarlhealsqmwqleaa

SCOP Domain Coordinates for d1u3da1:

Click to download the PDB-style file with coordinates for d1u3da1.
(The format of our PDB-style files is described here.)

Timeline for d1u3da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3da2