Lineage for d1u3da2 (1u3d A:13-197)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482913Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 482914Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 482915Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 482916Protein Cryptochrome [82367] (2 species)
  7. 482920Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110496] (2 PDB entries)
  8. 482921Domain d1u3da2: 1u3d A:13-197 [107639]
    Other proteins in same PDB: d1u3da1

Details for d1u3da2

PDB Entry: 1u3d (more details), 2.45 Å

PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana with AMPPNP bound

SCOP Domain Sequences for d1u3da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana)}
csivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsrwwlknslaqlds
slrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdhrakdvltaqgia
vrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppkkiisgdvskcva
dplvf

SCOP Domain Coordinates for d1u3da2:

Click to download the PDB-style file with coordinates for d1u3da2.
(The format of our PDB-style files is described here.)

Timeline for d1u3da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3da1