Lineage for d1u1la_ (1u1l A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724416Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 724417Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
  8. 724431Domain d1u1la_: 1u1l A: [107593]
    complexed with prn

Details for d1u1la_

PDB Entry: 1u1l (more details), 2 Å

PDB Description: crystal structure of up1 complexed with d(ttagggtt prn ggg); a human telomeric repeat containing nebularine
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOP Domain Sequences for d1u1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1la_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
sas

SCOP Domain Coordinates for d1u1la_:

Click to download the PDB-style file with coordinates for d1u1la_.
(The format of our PDB-style files is described here.)

Timeline for d1u1la_: