Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) |
Domain d1u1la_: 1u1l A: [107593] complexed with prn |
PDB Entry: 1u1l (more details), 2 Å
SCOP Domain Sequences for d1u1la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1la_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema sas
Timeline for d1u1la_: