Lineage for d1u0la2 (1u0l A:69-293)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696014Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species)
    circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain
  7. 696017Species Thermotoga maritima [TaxId:2336] [110543] (1 PDB entry)
  8. 696018Domain d1u0la2: 1u0l A:69-293 [107552]
    Other proteins in same PDB: d1u0la1, d1u0lb1, d1u0lc1

Details for d1u0la2

PDB Entry: 1u0l (more details), 9.89 Å

PDB Description: Crystal structure of YjeQ from Thermotoga maritima
PDB Compounds: (A:) Probable GTPase engC

SCOP Domain Sequences for d1u0la2:

Sequence, based on SEQRES records: (download)

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdk
qcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrr

Sequence, based on observed residues (ATOM records): (download)

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlr
kvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglk
lrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdcnhvdep
ecgvkeavengeiaesryenyvkmfyellgrr

SCOP Domain Coordinates for d1u0la2:

Click to download the PDB-style file with coordinates for d1u0la2.
(The format of our PDB-style files is described here.)

Timeline for d1u0la2: