SCOP 1.69: Domain d1tzwa_: 1tzw A:

Lineage for d1tzwa_ (1tzw A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (3 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)

6. Protein Antitermination factor NusB [48015] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries)

8. Domain d1tzwa_: 1tzw A: [107527]

Details for d1tzwa_

PDB Entry: 1tzw, 1.6 Å

PDB Description: T. maritima NusB, P3121, Form 2

SCOP Domain Sequences for d1tzwa_:

Sequence; same for both SEQRES and ATOM records:

>d1tzwa_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima}
mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
kfvngildriakehapkekfel

Timeline for d1tzwa_:

• d1tzwa_ is new in SCOP 1.69
  
• d1tzwa_ appears in SCOP 1.71
  
• d1tzwa_ appears in the current release, SCOPe 2.08