Class a: All alpha proteins [46456] (226 folds) |
Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (3 families) |
Family a.79.1.1: Antitermination factor NusB [48014] (1 protein) |
Protein Antitermination factor NusB [48015] (3 species) |
Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries) |
Domain d1tzwa_: 1tzw A: [107527] complexed with ca |
PDB Entry: 1tzw (more details), 1.6 Å
SCOP Domain Sequences for d1tzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzwa_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima} mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg kfvngildriakehapkekfel
Timeline for d1tzwa_: