Lineage for d1tzwa_ (1tzw A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540700Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 540701Superfamily a.79.1: NusB-like [48013] (3 families) (S)
  5. 540702Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)
  6. 540703Protein Antitermination factor NusB [48015] (3 species)
  7. 540709Species Thermotoga maritima [TaxId:243274] [109929] (5 PDB entries)
  8. 540711Domain d1tzwa_: 1tzw A: [107527]
    complexed with ca

Details for d1tzwa_

PDB Entry: 1tzw (more details), 1.6 Å

PDB Description: T. maritima NusB, P3121, Form 2

SCOP Domain Sequences for d1tzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzwa_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima}
mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
kfvngildriakehapkekfel

SCOP Domain Coordinates for d1tzwa_:

Click to download the PDB-style file with coordinates for d1tzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tzwa_: