Lineage for d1tzta_ (1tzt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719093Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
    automatically mapped to Pfam PF01029
  6. 2719094Protein Antitermination factor NusB [48015] (3 species)
  7. 2719101Species Thermotoga maritima [TaxId:2336] [109929] (5 PDB entries)
    Uniprot Q9X286
  8. 2719104Domain d1tzta_: 1tzt A: [107523]
    complexed with so4

Details for d1tzta_

PDB Entry: 1tzt (more details), 1.55 Å

PDB Description: T. maritima NusB, P21
PDB Compounds: (A:) N utilization substance protein B homolog

SCOPe Domain Sequences for d1tzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzta_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel

SCOPe Domain Coordinates for d1tzta_:

Click to download the PDB-style file with coordinates for d1tzta_.
(The format of our PDB-style files is described here.)

Timeline for d1tzta_: