![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.9: MdoG-like [110148] (1 protein) Pfam PF04349; Pfam coverage extends to the C-terminal immunoglobulin-like domain |
![]() | Protein Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain [110149] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110150] (1 PDB entry) Uniprot P33136 23-511 |
![]() | Domain d1txkb2: 1txk B:23-396 [107428] Other proteins in same PDB: d1txka1, d1txka3, d1txkb1, d1txkb3 complexed with na |
PDB Entry: 1txk (more details), 2.5 Å
SCOPe Domain Sequences for d1txkb2:
Sequence, based on SEQRES records: (download)
>d1txkb2 b.30.5.9 (B:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} fsiddvakqaqslagkgyetpksnlpsvfrdmkyadyqqiqfnhdkaywnnlktpfklef yhqgmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinsk dkndeivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkr ltiyalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqps pannyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrf edlddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfk ytitfsrdedklha
>d1txkb2 b.30.5.9 (B:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} fsiddvakqaqslagkgyetpksnlpsmkyadyqqiqfnhdkaywnnlktpfklefyhqg myfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinskdknd eivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkrltiy alldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqpspann yrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrfedld drydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfkytit fsrdedklha
Timeline for d1txkb2: