Lineage for d1txka2 (1txk A:23-396)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045090Family b.30.5.9: MdoG-like [110148] (1 protein)
    Pfam PF04349; Pfam coverage extends to the C-terminal immunoglobulin-like domain
  6. 2045091Protein Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain [110149] (1 species)
  7. 2045092Species Escherichia coli [TaxId:562] [110150] (1 PDB entry)
    Uniprot P33136 23-511
  8. 2045093Domain d1txka2: 1txk A:23-396 [107426]
    Other proteins in same PDB: d1txka1, d1txka3, d1txkb1, d1txkb3
    complexed with na

Details for d1txka2

PDB Entry: 1txk (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG
PDB Compounds: (A:) Glucans biosynthesis protein G

SCOPe Domain Sequences for d1txka2:

Sequence, based on SEQRES records: (download)

>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]}
fsiddvakqaqslagkgyetpksnlpsvfrdmkyadyqqiqfnhdkaywnnlktpfklef
yhqgmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinsk
dkndeivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkr
ltiyalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqps
pannyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrf
edlddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfk
ytitfsrdedklha

Sequence, based on observed residues (ATOM records): (download)

>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]}
fsiddvakqaqslagkgyetpksnlpsmkyadyqqiqfnhdkaywnnlktpfklefyhqg
myfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinskdknd
eivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkrltiy
alldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqpspann
yrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrfedld
drydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfkytit
fsrdedklha

SCOPe Domain Coordinates for d1txka2:

Click to download the PDB-style file with coordinates for d1txka2.
(The format of our PDB-style files is described here.)

Timeline for d1txka2: