SCOPe 2.05: Domain d1twjd_: 1twj D:

Lineage for d1twjd_ (1twj D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
   automatically mapped to Pfam PF02700

6. Protein PurS subunit of FGAM synthetase [82699] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [111001] (2 PDB entries)
   Uniprot P12049 # YexA

8. Domain d1twjd_: 1twj D: [107410]

Details for d1twjd_

PDB Entry: 1twj, 2.5 Å

PDB Description: Crystal Structure of B. subtilis PurS P21 Crystal Form

PDB Compounds: (D:) Hypothetical UPF0062 protein yexA

SCOPe Domain Sequences for d1twjd_:

Sequence; same for both SEQRES and ATOM records:

>d1twjd_ d.284.1.1 (D:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]}
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee

Timeline for d1twjd_:

• d1twjd_ first appeared in SCOP 1.69
  
• d1twjd_ appears in SCOPe 2.04
  
• d1twjd_ appears in SCOPe 2.06
  
• d1twjd_ appears in the current release, SCOPe 2.08