Lineage for d1twjd_ (1twj D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 517051Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 517052Superfamily d.284.1: PurS-like [82697] (2 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 517053Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
  6. 517054Protein PurS subunit of FGAM synthetase [82699] (2 species)
  7. 517058Species Bacillus subtilis [TaxId:1423] [111001] (2 PDB entries)
  8. 517064Domain d1twjd_: 1twj D: [107410]

Details for d1twjd_

PDB Entry: 1twj (more details), 2.5 Å

PDB Description: Crystal Structure of B. subtilis PurS P21 Crystal Form

SCOP Domain Sequences for d1twjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twjd_ d.284.1.1 (D:) PurS subunit of FGAM synthetase {Bacillus subtilis}
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee

SCOP Domain Coordinates for d1twjd_:

Click to download the PDB-style file with coordinates for d1twjd_.
(The format of our PDB-style files is described here.)

Timeline for d1twjd_: