SCOPe 2.03: Domain d1tw9c1: 1tw9 C:78-206

Lineage for d1tw9c1 (1tw9 C:78-206)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Heligmosomoides polygyrus [TaxId:6339] [109834] (1 PDB entry)
   Uniprot Q9NJQ6 # Fragment

8. Domain d1tw9c1: 1tw9 C:78-206 [107385]
   Other proteins in same PDB: d1tw9a2, d1tw9b2, d1tw9c2, d1tw9d2, d1tw9e2, d1tw9f2, d1tw9g2, d1tw9h2

Details for d1tw9c1

PDB Entry: 1tw9, 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

PDB Compounds: (C:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tw9c1:

Sequence, based on SEQRES records:

>d1tw9c1 a.45.1.1 (C:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
agatpfesalidsladaytdyraemktyyytalgfmtgdvdkpktdvllpartkflgfit
kflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkw
ietrpetpf

Sequence, based on observed residues (ATOM records):

>d1tw9c1 a.45.1.1 (C:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
agatpfesalidsladaytdyraemktyykpktdvllpartkflgfitkflkknssgflv
gdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkwietrpetpf

Timeline for d1tw9c1:

• d1tw9c1 first appeared in SCOP 1.69
  
• d1tw9c1 appears in SCOPe 2.02
  
• d1tw9c1 appears in SCOPe 2.04
  
• d1tw9c1 appears in the current release, SCOPe 2.08