Lineage for d1tw9c1 (1tw9 C:78-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713389Protein Class sigma GST [81351] (5 species)
  7. 2713393Species Heligmosomoides polygyrus [TaxId:6339] [109834] (1 PDB entry)
    Uniprot Q9NJQ6 # Fragment
  8. 2713396Domain d1tw9c1: 1tw9 C:78-206 [107385]
    Other proteins in same PDB: d1tw9a2, d1tw9a3, d1tw9b2, d1tw9b3, d1tw9c2, d1tw9c3, d1tw9d2, d1tw9d3, d1tw9e2, d1tw9e3, d1tw9f2, d1tw9f3, d1tw9g2, d1tw9g3, d1tw9h2, d1tw9h3

Details for d1tw9c1

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus
PDB Compounds: (C:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tw9c1:

Sequence, based on SEQRES records: (download)

>d1tw9c1 a.45.1.1 (C:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
agatpfesalidsladaytdyraemktyyytalgfmtgdvdkpktdvllpartkflgfit
kflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkw
ietrpetpf

Sequence, based on observed residues (ATOM records): (download)

>d1tw9c1 a.45.1.1 (C:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
agatpfesalidsladaytdyraemktyykpktdvllpartkflgfitkflkknssgflv
gdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkwietrpetpf

SCOPe Domain Coordinates for d1tw9c1:

Click to download the PDB-style file with coordinates for d1tw9c1.
(The format of our PDB-style files is described here.)

Timeline for d1tw9c1: