Lineage for d1tvfa1 (1tvf A:316-383)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333960Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 1333961Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 1333982Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
    rudiment form of the PBP-5-like domain
    automatically mapped to Pfam PF09211
  6. 1333983Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)
  7. 1333984Species Staphylococcus aureus [TaxId:1280] [110100] (2 PDB entries)
    Uniprot Q53613 21-383
  8. 1333985Domain d1tvfa1: 1tvf A:316-383 [107358]
    Other proteins in same PDB: d1tvfa2, d1tvfb2
    Structural genomics target
    complexed with so4, unl

Details for d1tvfa1

PDB Entry: 1tvf (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus
PDB Compounds: (A:) penicillin binding protein 4

SCOPe Domain Sequences for d1tvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvfa1 b.105.1.2 (A:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d1tvfa1:

Click to download the PDB-style file with coordinates for d1tvfa1.
(The format of our PDB-style files is described here.)

Timeline for d1tvfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvfa2