SCOP 1.69: Domain d1tvfa1: 1tvf A:316-383

Lineage for d1tvfa1 (1tvf A:316-383)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families)

5. Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
   rudiment form of the PBP-5-like domain

6. Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110100] (1 PDB entry)

8. Domain d1tvfa1: 1tvf A:316-383 [107358]
   Other proteins in same PDB: d1tvfa2, d1tvfb2

Details for d1tvfa1

PDB Entry: 1tvf, 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus

SCOP Domain Sequences for d1tvfa1:

Sequence; same for both SEQRES and ATOM records:

>d1tvfa1 b.105.1.2 (A:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

Timeline for d1tvfa1:

• d1tvfa1 is new in SCOP 1.69
  
• d1tvfa1 appears in SCOP 1.71
  
• d1tvfa1 appears in the current release, SCOPe 2.08