![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) |
![]() | Protein Homoserine dehydrogenase [55364] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (4 PDB entries) Uniprot P31116 |
![]() | Domain d1tveb2: 1tve B:151-340 [107357] Other proteins in same PDB: d1tvea1, d1tveb1 complexed with 178 |
PDB Entry: 1tve (more details), 3 Å
SCOPe Domain Sequences for d1tveb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tveb2 d.81.1.2 (B:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn pvviqgagag
Timeline for d1tveb2: