PDB entry 1tve

View 1tve on RCSB PDB site
Description: Homoserine Dehydrogenase in complex with 4-(4-hydroxy-3-isopropylphenylthio)-2-isopropylphenol
Class: oxidoreductase
Keywords: antifungal; small molecule screening; amino acid biosynthesis, OXIDOREDUCTASE
Deposited on 2004-06-29, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.289
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: hom6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tvea1, d1tvea2
  • Chain 'B':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: hom6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tveb1, d1tveb2
  • Heterogens: 178

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tveA (A:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tveB (B:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl