| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.11: Hypothetical protein egc068 from a soil-derived mobile gene cassette [110826] (1 protein) automatically mapped to Pfam PF07858 |
| Protein Hypothetical protein egc068 from a soil-derived mobile gene cassette [110827] (1 species) |
| Species uncultured organism [TaxId:155900] [110828] (1 PDB entry) Uniprot Q99IU3 |
| Domain d1tuha_: 1tuh A: [107345] complexed with act |
PDB Entry: 1tuh (more details), 1.85 Å
SCOPe Domain Sequences for d1tuha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}
neaeqnaetvrrgyaafnsgdmktltelfdenaswhtpgrsriagdhkgreaifaqfgry
ggetggtfkavllhvlksddgrvigihrntaerggkrldvgccivfefkngrvidgrehf
ydlyawdefwr
Timeline for d1tuha_: