Lineage for d1tr0f_ (1tr0 F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723797Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
  6. 723798Protein Boiling stable protein 1 [110953] (1 species)
  7. 723799Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
  8. 723805Domain d1tr0f_: 1tr0 F: [107266]

Details for d1tr0f_

PDB Entry: 1tr0 (more details), 1.8 Å

PDB Description: Crystal Structure of a boiling stable protein SP1
PDB Compounds: (F:) stable protein 1

SCOP Domain Sequences for d1tr0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr0f_ d.58.4.4 (F:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOP Domain Coordinates for d1tr0f_:

Click to download the PDB-style file with coordinates for d1tr0f_.
(The format of our PDB-style files is described here.)

Timeline for d1tr0f_: