SCOPe 2.02: Domain d1tqjc_: 1tqj C:

Lineage for d1tqjc_ (1tqj C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [110343] (1 PDB entry)
   Uniprot P74061

8. Domain d1tqjc_: 1tqj C: [107230]

Details for d1tqjc_

PDB Entry: 1tqj, 1.6 Å

PDB Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution

PDB Compounds: (C:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d1tqjc_:

Sequence, based on SEQRES records:

>d1tqjc_ c.1.2.2 (C:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdggl
kpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpep

Sequence, based on observed residues (ATOM records):

>d1tqjc_ c.1.2.2 (C:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}
knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
tpldfleyvlpvcdlilimsvnqsfipevlpkiralrqmcdergldpwievdgglkpnnt
wqvleaganaivagsavfnapnyaeaiagvrnskrpep

Timeline for d1tqjc_:

• d1tqjc_ first appeared in SCOP 1.69
  
• d1tqjc_ appears in SCOPe 2.01
  
• d1tqjc_ appears in SCOPe 2.03
  
• d1tqjc_ appears in the current release, SCOPe 2.08