SCOPe 2.04: Domain d1tq8e_: 1tq8 E:

Lineage for d1tq8e_ (1tq8 E:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein Hypothetical protein Rv1636 [110494] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110495] (1 PDB entry)
   Uniprot O06153

8. Domain d1tq8e_: 1tq8 E: [107208]
   Structural genomics target

Details for d1tq8e_

PDB Entry: 1tq8, 2.4 Å

PDB Description: crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv

PDB Compounds: (E:) hypothetical protein Rv1636

SCOPe Domain Sequences for d1tq8e_:

Sequence, based on SEQRES records:

>d1tq8e_ c.26.2.4 (E:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkdesyk
vtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglst
iagrllgsvpanvsrrakvdvlivhtt

Sequence, based on observed residues (ATOM records):

>d1tq8e_ c.26.2.4 (E:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}
slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpapiyeilhdakerahna
gaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvdv
livhtt

Timeline for d1tq8e_:

• d1tq8e_ first appeared in SCOP 1.69
  
• d1tq8e_ appears in SCOPe 2.03
  
• d1tq8e_ appears in SCOPe 2.05
  
• d1tq8e_ appears in the current release, SCOPe 2.08, called d1tq8e1