Lineage for d1tp6a_ (1tp6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936996Family d.17.4.12: PA1314-like [110829] (1 protein)
    COG4460
  6. 2936997Protein Hypothetical protein PA1314 [110830] (1 species)
  7. 2936998Species Pseudomonas aeruginosa [TaxId:287] [110831] (1 PDB entry)
    Uniprot Q9I430
  8. 2936999Domain d1tp6a_: 1tp6 A: [107184]
    Structural genomics target

Details for d1tp6a_

PDB Entry: 1tp6 (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a NTF-2 Like Protein of Unknown Function PA1314 from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA1314

SCOPe Domain Sequences for d1tp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]}
cayrreihhahvairdwlagdsradaldalmarfaedfsmvtphgvvldktalgelfrsk
ggtrpglrieidgesllasgvdgatlayreiqsdaagrserlstvvlhrddegrlywrhl
qetfcg

SCOPe Domain Coordinates for d1tp6a_:

Click to download the PDB-style file with coordinates for d1tp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1tp6a_: