![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.12: PA1314-like [110829] (1 protein) COG4460 |
![]() | Protein Hypothetical protein PA1314 [110830] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110831] (1 PDB entry) Uniprot Q9I430 |
![]() | Domain d1tp6a_: 1tp6 A: [107184] Structural genomics target |
PDB Entry: 1tp6 (more details), 1.5 Å
SCOPe Domain Sequences for d1tp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]} cayrreihhahvairdwlagdsradaldalmarfaedfsmvtphgvvldktalgelfrsk ggtrpglrieidgesllasgvdgatlayreiqsdaagrserlstvvlhrddegrlywrhl qetfcg
Timeline for d1tp6a_: