Lineage for d1to5b_ (1to5 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110785Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1110786Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1110799Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1110828Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
    Uniprot Q01137
  8. 1110834Domain d1to5b_: 1to5 B: [107167]
    complexed with act, cu, zn

Details for d1to5b_

PDB Entry: 1to5 (more details), 2.2 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1to5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to5b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

SCOPe Domain Coordinates for d1to5b_:

Click to download the PDB-style file with coordinates for d1to5b_.
(The format of our PDB-style files is described here.)

Timeline for d1to5b_: