Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins) there is an alpha-helical subdomain inserted in this domain automatically mapped to Pfam PF00667 |
Protein Neuronal nitric-oxide synthase FAD/NADP+ domain [69274] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [69275] (2 PDB entries) Uniprot P29476 750-1413 |
Domain d1tllb1: 1tll B:2959-3232 [107131] Other proteins in same PDB: d1tlla2, d1tlla3, d1tllb2, d1tllb3 complexed with fad, fmn, nap, so3 |
PDB Entry: 1tll (more details), 2.3 Å
SCOPe Domain Sequences for d1tllb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tllb1 b.43.4.1 (B:2959-3232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} sndrswkrnkfrltyvaeapdltqglsnvhkkrvsaarllsrqnlqspkssrstifvrlh tngnqelqyqpgdhlgvfpgnhedlvnalierledappanhvvkvemleerntalgvisn wkdesrlppctifqafkyyldittpptplqlqqfaslatnekekqrllvlskglqeyeew kwgknptmvevleefpsiqmpatllltqlsllqpryysissspdmypdevhltvaivsyh trdgegpvhhgvcsswlnriqaddvvpcfvrgap
Timeline for d1tllb1: