![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) ![]() the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965) |
![]() | Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins) automatically mapped to Pfam PF12925 |
![]() | Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109846] (3 PDB entries) Uniprot P05067 374-569 # structures are known for other fragments: 28-123 (56494); 124-189 (89814); 287-344 (57371); 681-/-711 ((58608)) |
![]() | Domain d1tkna_: 1tkn A: [107107] |
PDB Entry: 1tkn (more details)
SCOPe Domain Sequences for d1tkna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkna_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]} rveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvd pkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellqke
Timeline for d1tkna_: