Lineage for d1tkkd2 (1tkk D:2-125)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412877Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 1412878Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
    Uniprot O34508
  8. 1412886Domain d1tkkd2: 1tkk D:2-125 [107096]
    Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1
    complexed with ala, mg

Details for d1tkkd2

PDB Entry: 1tkk (more details), 2.1 Å

PDB Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis
PDB Compounds: (D:) similar to chloromuconate cycloisomerase

SCOPe Domain Sequences for d1tkkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkkd2 d.54.1.1 (D:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds
iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq
mlgg

SCOPe Domain Coordinates for d1tkkd2:

Click to download the PDB-style file with coordinates for d1tkkd2.
(The format of our PDB-style files is described here.)

Timeline for d1tkkd2: