Lineage for d1tkkd2 (1tkk D:2-125)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503641Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 503642Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
  8. 503650Domain d1tkkd2: 1tkk D:2-125 [107096]
    Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1

Details for d1tkkd2

PDB Entry: 1tkk (more details), 2.1 Å

PDB Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis

SCOP Domain Sequences for d1tkkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkkd2 d.54.1.1 (D:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds
iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq
mlgg

SCOP Domain Coordinates for d1tkkd2:

Click to download the PDB-style file with coordinates for d1tkkd2.
(The format of our PDB-style files is described here.)

Timeline for d1tkkd2: