SCOP 1.73: Domain d1tk7a1: 1tk7 A:1-45

Lineage for d1tk7a1 (1tk7 A:1-45)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (1 family)

5. Family b.72.1.1: WW domain [51046] (10 proteins)

6. Protein Suppressor of deltex (Cg4244-pb) [110301] (1 species)
   duplication: contains two WW domains connected by a helical linker

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110302] (1 PDB entry)

8. Domain d1tk7a1: 1tk7 A:1-45 [107077]

Details for d1tk7a1

PDB Entry: 1tk7

PDB Description: nmr structure of ww domains (ww3-4) from suppressor of deltex

PDB Compounds: (A:) cg4244-pb

SCOP Domain Sequences for d1tk7a1:

Sequence; same for both SEQRES and ATOM records:

>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gspefhmdalgplpdgwekkiqsdnrvyfvnhknrttqwedprtq

Timeline for d1tk7a1:

• d1tk7a1 first appeared in SCOP 1.69
  
• d1tk7a1 appears in SCOP 1.71
  
• d1tk7a1 appears in SCOP 1.75
  
• d1tk7a1 appears in the current release, SCOPe 2.08