Lineage for d1tk7a2 (1tk7 A:46-88)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676271Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 676272Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 676273Family b.72.1.1: WW domain [51046] (10 proteins)
  6. 676304Protein Suppressor of deltex (Cg4244-pb) [110301] (1 species)
    duplication: contains two WW domains connected by a helical linker
  7. 676305Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110302] (1 PDB entry)
  8. 676307Domain d1tk7a2: 1tk7 A:46-88 [107078]

Details for d1tk7a2

PDB Entry: 1tk7 (more details)

PDB Description: nmr structure of ww domains (ww3-4) from suppressor of deltex
PDB Compounds: (A:) cg4244-pb

SCOP Domain Sequences for d1tk7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk7a2 b.72.1.1 (A:46-88) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gqevslinegplppgweirytaagerffvdhntrrttfedprp

SCOP Domain Coordinates for d1tk7a2:

Click to download the PDB-style file with coordinates for d1tk7a2.
(The format of our PDB-style files is described here.)

Timeline for d1tk7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tk7a1