| Class g: Small proteins [56992] (90 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger [111448] (1 protein) Pfam PF01258; Pfam coverage extends to the second helix of the upstream alpha-hairpin domain |
| Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species) |
| Species Escherichia coli [TaxId:562] [111450] (1 PDB entry) Uniprot P18274 7-151 |
| Domain d1tjld2: 1tjl D:111-151 [107034] Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1 complexed with zn |
PDB Entry: 1tjl (more details), 2 Å
SCOPe Domain Sequences for d1tjld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjld2 g.39.1.13 (D:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli [TaxId: 562]}
fgycescgveigirrlearptadlcidcktlaeirekqmag
Timeline for d1tjld2: