Lineage for d1thzb1 (1thz B:4-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859656Family c.24.1.3: Inosicase [63971] (1 protein)
  6. 2859657Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)
  7. 2859658Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries)
    Uniprot P31335
  8. 2859660Domain d1thzb1: 1thz B:4-200 [106923]
    Other proteins in same PDB: d1thza2, d1thzb2
    complexed with 326, k

Details for d1thzb1

PDB Entry: 1thz (more details), 1.8 Å

PDB Description: Crystal Structure of Avian AICAR Transformylase in Complex with a Novel Inhibitor Identified by Virtual Ligand Screening
PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1thzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thzb1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

SCOPe Domain Coordinates for d1thzb1:

Click to download the PDB-style file with coordinates for d1thzb1.
(The format of our PDB-style files is described here.)

Timeline for d1thzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1thzb2