![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.3: Inosicase [63971] (1 protein) |
![]() | Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries) Uniprot P31335 |
![]() | Domain d1thzb1: 1thz B:4-200 [106923] Other proteins in same PDB: d1thza2, d1thzb2 complexed with 326, k |
PDB Entry: 1thz (more details), 1.8 Å
SCOPe Domain Sequences for d1thzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thzb1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht aqydaaisdyfrkeysk
Timeline for d1thzb1: