Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (8 PDB entries) Uniprot Q93068 |
Domain d1tgzb_: 1tgz B: [106902] Other proteins in same PDB: d1tgza_ complexed with so4 |
PDB Entry: 1tgz (more details), 2.8 Å
SCOPe Domain Sequences for d1tgzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgzb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgg
Timeline for d1tgzb_: