Lineage for d1tgeb1 (1tge B:298-395)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937854Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 937855Protein Envelope glycoprotein [49213] (5 species)
  7. 937856Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 937870Domain d1tgeb1: 1tge B:298-395 [106896]
    Other proteins in same PDB: d1tgea2, d1tgeb2, d1tgec2

Details for d1tgeb1

PDB Entry: 1tge (more details), 12.5 Å

PDB Description: the structure of immature dengue virus at 12.5 angstrom
PDB Compounds: (B:) Envelope glycoprotein

SCOPe Domain Sequences for d1tgeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgeb1 b.1.18.4 (B:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg

SCOPe Domain Coordinates for d1tgeb1:

Click to download the PDB-style file with coordinates for d1tgeb1.
(The format of our PDB-style files is described here.)

Timeline for d1tgeb1: