Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein Mistletoe lectin I A-chain [56381] (1 species) |
Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries) different sequence variants Uniprot P81446 1-249 Uniprot Q6ITZ3 1-240 |
Domain d1tfma_: 1tfm A: [106855] Other proteins in same PDB: d1tfmb1, d1tfmb2 complexed with gal, nag, p6c |
PDB Entry: 1tfm (more details), 2.8 Å
SCOPe Domain Sequences for d1tfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfma_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]} yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
Timeline for d1tfma_: