Lineage for d1tfma_ (1tfm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000048Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 3000049Species European mistletoe (Viscum album) [TaxId:3972] [56382] (12 PDB entries)
    different sequence variants
    Uniprot P81446 1-249
    Uniprot Q6ITZ3 1-240
  8. 3000058Domain d1tfma_: 1tfm A: [106855]
    Other proteins in same PDB: d1tfmb1, d1tfmb2
    complexed with gal, nag, p6c

Details for d1tfma_

PDB Entry: 1tfm (more details), 2.8 Å

PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form
PDB Compounds: (A:) Himalayan mistletoe ribosome-inactivating protein

SCOPe Domain Sequences for d1tfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfma_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc

SCOPe Domain Coordinates for d1tfma_:

Click to download the PDB-style file with coordinates for d1tfma_.
(The format of our PDB-style files is described here.)

Timeline for d1tfma_: