Lineage for d1tf7a1 (1tf7 A:14-255)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989225Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 989385Protein Circadian clock protein KaiC [110558] (1 species)
    duplication: contains two copies of this domain
  7. 989386Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries)
    Uniprot Q79PF4 14-497
  8. 989387Domain d1tf7a1: 1tf7 A:14-255 [106838]
    complexed with atp

Details for d1tf7a1

PDB Entry: 1tf7 (more details), 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC
PDB Compounds: (A:) KaiC

SCOPe Domain Sequences for d1tf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
lt

SCOPe Domain Coordinates for d1tf7a1:

Click to download the PDB-style file with coordinates for d1tf7a1.
(The format of our PDB-style files is described here.)

Timeline for d1tf7a1: